Class b: All beta proteins [48724] (180 folds) |
Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) probably related to the second domain and its superfamiy by a circular permutation |
Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins) |
Protein Elongation factor Tu (EF-Tu) [50467] (4 species) |
Species Escherichia coli [TaxId:562] [50468] (9 PDB entries) Uniprot P02990 |
Domain d1d8ta2: 1d8t A:297-393 [25726] Other proteins in same PDB: d1d8ta1, d1d8ta3, d1d8tb1, d1d8tb3 complexed with act, gdp, mg |
PDB Entry: 1d8t (more details), 2.35 Å
SCOPe Domain Sequences for d1d8ta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d8ta2 b.44.1.1 (A:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]} tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni kmvvtlihpiamddglrfaireggrtvgagvvakvlg
Timeline for d1d8ta2: