Lineage for d4q7jb3 (4q7j B:297-393)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544755Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins)
  6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 1544790Species Escherichia coli [TaxId:562] [50468] (8 PDB entries)
    Uniprot P02990
  8. 1544803Domain d4q7jb3: 4q7j B:297-393 [259277]
    Other proteins in same PDB: d4q7ja1, d4q7ja2, d4q7ja3, d4q7jb1, d4q7jb2, d4q7je1, d4q7je2, d4q7je3, d4q7jf1, d4q7jf2
    automated match to d1d8ta2
    protein/RNA complex; complexed with so4

Details for d4q7jb3

PDB Entry: 4q7j (more details), 2.9 Å

PDB Description: complex structure of viral rna polymerase
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d4q7jb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7jb3 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvlg

SCOPe Domain Coordinates for d4q7jb3:

Click to download the PDB-style file with coordinates for d4q7jb3.
(The format of our PDB-style files is described here.)

Timeline for d4q7jb3: