Lineage for d4q7jb2 (4q7j B:205-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793069Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2793076Species Escherichia coli [TaxId:562] [50450] (9 PDB entries)
    Uniprot P02990
  8. 2793090Domain d4q7jb2: 4q7j B:205-296 [259276]
    Other proteins in same PDB: d4q7ja1, d4q7ja2, d4q7ja3, d4q7jb1, d4q7jb3, d4q7je1, d4q7je2, d4q7je3, d4q7jf1, d4q7jf3
    automated match to d1d8ta1
    protein/RNA complex; complexed with so4

Details for d4q7jb2

PDB Entry: 4q7j (more details), 2.9 Å

PDB Description: complex structure of viral rna polymerase
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d4q7jb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q7jb2 b.43.3.1 (B:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d4q7jb2:

Click to download the PDB-style file with coordinates for d4q7jb2.
(The format of our PDB-style files is described here.)

Timeline for d4q7jb2: