Lineage for d4q7jb1 (4q7j B:8-204)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species)
  7. 1594741Species Escherichia coli [TaxId:562] [52627] (10 PDB entries)
    Uniprot P02990
  8. 1594756Domain d4q7jb1: 4q7j B:8-204 [259275]
    Other proteins in same PDB: d4q7ja1, d4q7ja2, d4q7ja3, d4q7jb2, d4q7jb3, d4q7je1, d4q7je2, d4q7je3, d4q7jf2, d4q7jf3
    automated match to d1d8ta3
    protein/RNA complex; complexed with so4

Details for d4q7jb1

PDB Entry: 4q7j (more details), 2.9 Å

PDB Description: complex structure of viral rna polymerase
PDB Compounds: (B:) Elongation factor Tu 1

SCOPe Domain Sequences for d4q7jb1:

Sequence, based on SEQRES records: (download)

>d4q7jb1 c.37.1.8 (B:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshv
eydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgv
pyiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweak
ilelagfldsyipeper

Sequence, based on observed residues (ATOM records): (download)

>d4q7jb1 c.37.1.8 (B:8-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]}
tkphvnvgtighvdhgkttltaaittvlaktygshveydtptrhyahvdcpghadyvknm
itgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvddeellelvem
evrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipeper

SCOPe Domain Coordinates for d4q7jb1:

Click to download the PDB-style file with coordinates for d4q7jb1.
(The format of our PDB-style files is described here.)

Timeline for d4q7jb1: