| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.43: EF-Ts domain-like [54712] (2 superfamilies) beta(2)-alpha(n)-beta; 2 layers a/b; antiparallel sheet: 123 |
Superfamily d.43.1: Elongation factor Ts (EF-Ts), dimerisation domain [54713] (1 family) ![]() comprises two structural repeats of this fold |
| Family d.43.1.1: Elongation factor Ts (EF-Ts), dimerisation domain [54714] (1 protein) |
| Protein Elongation factor Ts (EF-Ts), dimerisation domain [63422] (3 species) |
| Species Escherichia coli [TaxId:562] [54716] (2 PDB entries) duplication: consists of two subdomains of this fold |
| Domain d4q7je3: 4q7j E:140-282 [259274] Other proteins in same PDB: d4q7ja1, d4q7jb1, d4q7jb2, d4q7jb3, d4q7je1, d4q7jf1, d4q7jf2, d4q7jf3 automated match to d1efub2 protein/RNA complex; complexed with so4 |
PDB Entry: 4q7j (more details), 2.9 Å
SCOPe Domain Sequences for d4q7je3:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q7je3 d.43.1.1 (E:140-282) Elongation factor Ts (EF-Ts), dimerisation domain {Escherichia coli [TaxId: 562]}
dvlgsyqhgarigvlvaakgadeelvkhiamhvaaskpefikpedvsaevvekeyqvqld
iamqsgkpkeiaekmvegrmkkftgevsltgqpfvmepsktvgqllkehnaevtgfirfe
vgegiekvetdfaaevaamskqs
Timeline for d4q7je3: