Lineage for d3wtvb_ (3wtv B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550779Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily)
    barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices
  4. 1550780Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) (S)
    automatically mapped to Pfam PF02312
  5. 1550781Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins)
  6. 1550795Protein automated matches [259048] (1 species)
    not a true protein
  7. 1550796Species Mus musculus [TaxId:10090] [259049] (3 PDB entries)
  8. 1550798Domain d3wtvb_: 3wtv B: [259142]
    Other proteins in same PDB: d3wtva_, d3wtvc_, d3wtvf_
    automated match to d2jhba_
    protein/DNA complex

Details for d3wtvb_

PDB Entry: 3wtv (more details), 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (B:) Core-binding factor subunit beta

SCOPe Domain Sequences for d3wtvb_:

Sequence, based on SEQRES records: (download)

>d3wtvb_ b.54.1.1 (B:) automated matches {Mus musculus [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedalaq

Sequence, based on observed residues (ATOM records): (download)

>d3wtvb_ b.54.1.1 (B:) automated matches {Mus musculus [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee
raqqedalaq

SCOPe Domain Coordinates for d3wtvb_:

Click to download the PDB-style file with coordinates for d3wtvb_.
(The format of our PDB-style files is described here.)

Timeline for d3wtvb_: