| Class b: All beta proteins [48724] (180 folds) |
| Fold b.54: Core binding factor beta, CBF [50722] (1 superfamily) barrel, closed; n=6, S=10; meander; capped at both ends by alpha-helices |
Superfamily b.54.1: Core binding factor beta, CBF [50723] (1 family) ![]() automatically mapped to Pfam PF02312 |
| Family b.54.1.1: Core binding factor beta, CBF [50724] (2 proteins) |
| Protein automated matches [259048] (1 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [259049] (7 PDB entries) |
| Domain d3wtvb_: 3wtv B: [259142] Other proteins in same PDB: d3wtva_, d3wtvc_, d3wtvf_ automated match to d2jhba_ protein/DNA complex |
PDB Entry: 3wtv (more details), 2.7 Å
SCOPe Domain Sequences for d3wtvb_:
Sequence, based on SEQRES records: (download)
>d3wtvb_ b.54.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpaswqgeqrqtpsreyvdlereagkvylkapmilngvcviwkgwidlhrldg
mgclefdeeraqqedalaq
>d3wtvb_ b.54.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
prvvpdqrskfeneeffrklsreceikytgfrdrpheerqtrfqnacrdgrseiafvatg
tnlslqffpapsreyvdlereagkvylkapmilngvcviwkgwidlhrldgmgclefdee
raqqedalaq
Timeline for d3wtvb_:
View in 3DDomains from other chains: (mouse over for more information) d3wtva_, d3wtvc_, d3wtvf_, d3wtvg_ |