Lineage for d3wtva_ (3wtv A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1525229Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1525684Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1526006Family b.2.5.6: RUNT domain [81318] (2 proteins)
    automatically mapped to Pfam PF00853
  6. 1526033Protein automated matches [190872] (1 species)
    not a true protein
  7. 1526034Species Mouse (Mus musculus) [TaxId:10090] [188223] (6 PDB entries)
  8. 1526040Domain d3wtva_: 3wtv A: [259144]
    Other proteins in same PDB: d3wtvb_, d3wtvc_
    automated match to d1hjbc_
    protein/DNA complex

Details for d3wtva_

PDB Entry: 3wtv (more details), 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1(v170g), runx1, cbfbeta, and the tcralpha gene enhancer dna
PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d3wtva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wtva_ b.2.5.6 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitgdgprepr

SCOPe Domain Coordinates for d3wtva_:

Click to download the PDB-style file with coordinates for d3wtva_.
(The format of our PDB-style files is described here.)

Timeline for d3wtva_: