SCOPe 2.08: Domain d4u3ja1: 4u3j A:1-246

Lineage for d4u3ja1 (4u3j A:1-246)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families)
   automatically mapped to Pfam PF00091

5. Family c.32.1.0: automated matches [227136] (1 protein)
   not a true family

6. Protein automated matches [226838] (5 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [259118] (1 PDB entry)

8. Domain d4u3ja1: 4u3j A:1-246 [259119]
   Other proteins in same PDB: d4u3ja2, d4u3jb2
   automated match to d1tuba1
   complexed with gtp, mg

Details for d4u3ja1

PDB Entry: 4u3j, 2.81 Å

PDB Description: tog2:alpha/beta-tubulin complex

PDB Compounds: (A:) Tubulin alpha-1 chain

SCOPe Domain Sequences for d4u3ja1:

Sequence; same for both SEQRES and ATOM records:

>d4u3ja1 c.32.1.0 (A:1-246) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mrevisinvgqagcqignacwelyslehgikpdghledglskpkggeegfstffhetgyg
kfvpraiyvdlepnvidevrngpykdlfhpeqlisgkedaannyarghytvgreilgdvl
drirkladqcdglqgflfthslgggtgsglgsllleelsaeygkksklefavypapqvst
svvepyntvltthttlehadctfmvdneaiydmckrnldiprpsfanlnnliaqvvssvt
aslrfd

Timeline for d4u3ja1:

• d4u3ja1 first appeared in SCOPe 2.04
  
• d4u3ja1 appears in SCOPe 2.07