Lineage for d4u3ja1 (4u3j A:1-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107977Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 2107978Protein automated matches [226838] (4 species)
    not a true protein
  7. 2107991Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [259118] (1 PDB entry)
  8. 2107992Domain d4u3ja1: 4u3j A:1-246 [259119]
    Other proteins in same PDB: d4u3ja2, d4u3jb2
    automated match to d1tuba1
    complexed with gtp, mg

Details for d4u3ja1

PDB Entry: 4u3j (more details), 2.81 Å

PDB Description: tog2:alpha/beta-tubulin complex
PDB Compounds: (A:) Tubulin alpha-1 chain

SCOPe Domain Sequences for d4u3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u3ja1 c.32.1.0 (A:1-246) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mrevisinvgqagcqignacwelyslehgikpdghledglskpkggeegfstffhetgyg
kfvpraiyvdlepnvidevrngpykdlfhpeqlisgkedaannyarghytvgreilgdvl
drirkladqcdglqgflfthslgggtgsglgsllleelsaeygkksklefavypapqvst
svvepyntvltthttlehadctfmvdneaiydmckrnldiprpsfanlnnliaqvvssvt
aslrfd

SCOPe Domain Coordinates for d4u3ja1:

Click to download the PDB-style file with coordinates for d4u3ja1.
(The format of our PDB-style files is described here.)

Timeline for d4u3ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u3ja2