Lineage for d1tuba1 (1tub A:1-245)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2863166Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2863167Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2863168Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2863262Protein Tubulin alpha-subunit [52494] (3 species)
  7. 2863271Species Pig (Sus scrofa) [TaxId:9823] [52495] (3 PDB entries)
  8. 2863272Domain d1tuba1: 1tub A:1-245 [31751]
    Other proteins in same PDB: d1tuba2, d1tubb1, d1tubb2
    complexed with gdp, gtp, txl

Details for d1tuba1

PDB Entry: 1tub (more details), 3.7 Å

PDB Description: tubulin alpha-beta dimer, electron diffraction
PDB Compounds: (A:) tubulin

SCOPe Domain Sequences for d1tuba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tuba1 c.32.1.1 (A:1-245) Tubulin alpha-subunit {Pig (Sus scrofa) [TaxId: 9823]}
mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk
hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld
rirkladqctglqgfsvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta
vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrligqivssita
slrfd

SCOPe Domain Coordinates for d1tuba1:

Click to download the PDB-style file with coordinates for d1tuba1.
(The format of our PDB-style files is described here.)

Timeline for d1tuba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tuba2