Lineage for d4u3jb2 (4u3j B:244-430)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960057Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [224936] (2 PDB entries)
  8. 2960060Domain d4u3jb2: 4u3j B:244-430 [259124]
    Other proteins in same PDB: d4u3ja1, d4u3jb1
    automated match to d4ffbb2
    complexed with gtp, mg

Details for d4u3jb2

PDB Entry: 4u3j (more details), 2.81 Å

PDB Description: tog2:alpha/beta-tubulin complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d4u3jb2:

Sequence, based on SEQRES records: (download)

>d4u3jb2 d.79.2.0 (B:244-430) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gqlnsdlrklavnlvpfprlhffmvgyapltaigsqsfrsltvpeltqqmfdaknmmaaa
dprngryltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldm
aatfianstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyq
qyqeatv

Sequence, based on observed residues (ATOM records): (download)

>d4u3jb2 d.79.2.0 (B:244-430) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gqlnsdlrklavnlvpfprlhffmvgyapltarsltvpeltqqmfdaknmmaaadprngr
yltvaaffrgkvsvkevedemhkvqsknsdyfvewipnnvqtavcsvapqgldmaatfia
nstsiqelfkrvgdqfsamfkrkaflhwytsegmdelefseaesnmndlvseyqqyqeat
v

SCOPe Domain Coordinates for d4u3jb2:

Click to download the PDB-style file with coordinates for d4u3jb2.
(The format of our PDB-style files is described here.)

Timeline for d4u3jb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4u3jb1