Lineage for d2mgza_ (2mgz A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652682Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 1652683Protein automated matches [190896] (7 species)
    not a true protein
  7. 1652695Species Caenorhabditis elegans [TaxId:6239] [258940] (1 PDB entry)
  8. 1652696Domain d2mgza_: 2mgz A: [258941]
    Other proteins in same PDB: d2mgzb_
    automated match to d1p1ta_
    protein/RNA complex

Details for d2mgza_

PDB Entry: 2mgz (more details)

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna
PDB Compounds: (A:) Protein ASD-1, isoform a

SCOPe Domain Sequences for d2mgza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgza_ d.58.7.0 (A:) automated matches {Caenorhabditis elegans [TaxId: 6239]}
gdgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadra
raefngttiegrrvevnlatqrvhnkkakplmsv

SCOPe Domain Coordinates for d2mgza_:

Click to download the PDB-style file with coordinates for d2mgza_.
(The format of our PDB-style files is described here.)

Timeline for d2mgza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mgzb_