Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (7 species) not a true protein |
Species Caenorhabditis elegans [TaxId:6239] [258940] (1 PDB entry) |
Domain d2mgza_: 2mgz A: [258941] Other proteins in same PDB: d2mgzb_ automated match to d1p1ta_ protein/RNA complex |
PDB Entry: 2mgz (more details)
SCOPe Domain Sequences for d2mgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mgza_ d.58.7.0 (A:) automated matches {Caenorhabditis elegans [TaxId: 6239]} gdgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadra raefngttiegrrvevnlatqrvhnkkakplmsv
Timeline for d2mgza_: