Lineage for d2mgzb_ (2mgz B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652591Protein automated matches [190332] (3 species)
    not a true protein
  7. 1652592Species Caenorhabditis elegans [TaxId:6239] [258944] (3 PDB entries)
  8. 1652595Domain d2mgzb_: 2mgz B: [258945]
    Other proteins in same PDB: d2mgza_
    automated match to d2cqda1
    protein/RNA complex

Details for d2mgzb_

PDB Entry: 2mgz (more details)

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna
PDB Compounds: (B:) Protein SUP-12, isoform a

SCOPe Domain Sequences for d2mgzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgzb_ d.58.7.1 (B:) automated matches {Caenorhabditis elegans [TaxId: 6239]}
gstnaepvvgsrdtmftkifvgglpyhtsdktlheyfeqfgdieeavvitdrntqksrgy
gfvtmkdrasaerackdpnpiidgrkanvnlaylgakprtnvqla

SCOPe Domain Coordinates for d2mgzb_:

Click to download the PDB-style file with coordinates for d2mgzb_.
(The format of our PDB-style files is described here.)

Timeline for d2mgzb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2mgza_