SCOPe 2.08: Domain d2mgza1: 2mgz A:97-189

Lineage for d2mgza1 (2mgz A:97-189)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258940] (1 PDB entry)

8. Domain d2mgza1: 2mgz A:97-189 [258941]
   Other proteins in same PDB: d2mgza2, d2mgzb1, d2mgzb2
   automated match to d1p1ta_
   protein/RNA complex

Details for d2mgza1

PDB Entry: 2mgz

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna

PDB Compounds: (A:) Protein ASD-1, isoform a

SCOPe Domain Sequences for d2mgza1:

Sequence; same for both SEQRES and ATOM records:

>d2mgza1 d.58.7.0 (A:97-189) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadrar
aefngttiegrrvevnlatqrvhnkkakplmsv

Timeline for d2mgza1:

• d2mgza1 first appeared in SCOPe 2.04, called d2mgza_
  
• d2mgza1 appears in SCOPe 2.07