SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2mgza1 (2mgz A:97-189)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (10 species)
    not a true protein
  7. 2175207Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258940] (1 PDB entry)
  8. 2175208Domain d2mgza1: 2mgz A:97-189 [258941]
    Other proteins in same PDB: d2mgza2, d2mgzb1, d2mgzb2
    automated match to d1p1ta_
    protein/RNA complex

Details for d2mgza1

PDB Entry: 2mgz (more details)

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna
PDB Compounds: (A:) Protein ASD-1, isoform a

SCOPe Domain Sequences for d2mgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgza1 d.58.7.0 (A:97-189) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadrar
aefngttiegrrvevnlatqrvhnkkakplmsv

SCOPe Domain Coordinates for d2mgza1:

Click to download the PDB-style file with coordinates for d2mgza1.
(The format of our PDB-style files is described here.)

Timeline for d2mgza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mgza2