Lineage for d2mgza1 (2mgz A:97-189)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2175050Family d.58.7.0: automated matches [191529] (1 protein)
    not a true family
  6. 2175051Protein automated matches [190896] (11 species)
    not a true protein
  7. 2175207Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258940] (1 PDB entry)
  8. 2175208Domain d2mgza1: 2mgz A:97-189 [258941]
    Other proteins in same PDB: d2mgza2, d2mgzb1, d2mgzb2
    automated match to d1p1ta_
    protein/RNA complex

Details for d2mgza1

PDB Entry: 2mgz (more details)

PDB Description: solution structure of rbfox family asd-1 rrm and sup-12 rrm in ternary complex with rna
PDB Compounds: (A:) Protein ASD-1, isoform a

SCOPe Domain Sequences for d2mgza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mgza1 d.58.7.0 (A:97-189) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
dgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadrar
aefngttiegrrvevnlatqrvhnkkakplmsv

SCOPe Domain Coordinates for d2mgza1:

Click to download the PDB-style file with coordinates for d2mgza1.
(The format of our PDB-style files is described here.)

Timeline for d2mgza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mgza2