![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (11 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [258940] (1 PDB entry) |
![]() | Domain d2mgza1: 2mgz A:97-189 [258941] Other proteins in same PDB: d2mgza2, d2mgzb1, d2mgzb2 automated match to d1p1ta_ protein/RNA complex |
PDB Entry: 2mgz (more details)
SCOPe Domain Sequences for d2mgza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mgza1 d.58.7.0 (A:97-189) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} dgprrlhvsnipfkyrepdltamfekvgpvvdveiifnergskgfgfvtmqnpddadrar aefngttiegrrvevnlatqrvhnkkakplmsv
Timeline for d2mgza1: