Lineage for d1btza_ (1btz A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15330Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries)
  8. 15382Domain d1btza_: 1btz A: [25847]

Details for d1btza_

PDB Entry: 1btz (more details), 2 Å

PDB Description: Episelection: novel KI ~nanomolar inhibitors of serine proteases selected by binding or chemistry on an enzyme surface

SCOP Domain Sequences for d1btza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1btza_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1btza_:

Click to download the PDB-style file with coordinates for d1btza_.
(The format of our PDB-style files is described here.)

Timeline for d1btza_: