Lineage for d4q4zf1 (4q4z F:78-257)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735969Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2735970Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2735971Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2736017Protein automated matches [254474] (3 species)
    not a true protein
  7. 2736025Species Thermus thermophilus [TaxId:300852] [258305] (2 PDB entries)
  8. 2736026Domain d4q4zf1: 4q4z F:78-257 [258306]
    Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zc_, d4q4zd_, d4q4ze_, d4q4zf2, d4q4zf3
    automated match to d1smyf3
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4q4zf1

PDB Entry: 4q4z (more details), 2.9 Å

PDB Description: Thermus thermophilus RNA polymerase de novo transcription initiation complex
PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d4q4zf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q4zf1 a.177.1.1 (F:78-257) automated matches {Thermus thermophilus [TaxId: 300852]}
sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg
sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs
iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart

SCOPe Domain Coordinates for d4q4zf1:

Click to download the PDB-style file with coordinates for d4q4zf1.
(The format of our PDB-style files is described here.)

Timeline for d4q4zf1: