![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
![]() | Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) ![]() |
![]() | Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
![]() | Protein automated matches [254474] (3 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [258305] (2 PDB entries) |
![]() | Domain d4q4zf1: 4q4z F:78-257 [258306] Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zc_, d4q4zd_, d4q4ze_, d4q4zf2, d4q4zf3 automated match to d1smyf3 protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn |
PDB Entry: 4q4z (more details), 2.9 Å
SCOPe Domain Sequences for d4q4zf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q4zf1 a.177.1.1 (F:78-257) automated matches {Thermus thermophilus [TaxId: 300852]} sdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvrakilg sarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlrlvvs iakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiadqart
Timeline for d4q4zf1: