Lineage for d4q4zc_ (4q4z C:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574252Family e.29.1.1: RNA-polymerase beta [64485] (4 proteins)
  6. 2574291Protein RNA-polymerase beta [64488] (2 species)
  7. 2574297Species Thermus thermophilus [TaxId:274] [75609] (10 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 2574308Domain d4q4zc_: 4q4z C: [258298]
    Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zd_, d4q4ze_, d4q4zf1, d4q4zf2, d4q4zf3
    automated match to d1smyc_
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4q4zc_

PDB Entry: 4q4z (more details), 2.9 Å

PDB Description: Thermus thermophilus RNA polymerase de novo transcription initiation complex
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d4q4zc_:

Sequence, based on SEQRES records: (download)

>d4q4zc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglask

Sequence, based on observed residues (ATOM records): (download)

>d4q4zc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeglvl
dfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgs
fiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkv
nkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgd
ppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflpt
lrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgseds
ltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfd
vrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvym
tateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnl
ipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakv
dgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfl
algqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdi
phlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvk
dtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnk
gvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispif
dgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkel
flqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaq
fggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfr
vlvkelqalaldvqtldekdnpvdifeglask

SCOPe Domain Coordinates for d4q4zc_:

Click to download the PDB-style file with coordinates for d4q4zc_.
(The format of our PDB-style files is described here.)

Timeline for d4q4zc_: