Lineage for d1sgta_ (1sgt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794586Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2794771Protein Trypsin [50504] (1 species)
  7. 2794772Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (7 PDB entries)
  8. 2794779Domain d1sgta_: 1sgt A: [25814]
    complexed with ca

Details for d1sgta_

PDB Entry: 1sgt (more details), 1.7 Å

PDB Description: refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1sgta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sgta_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqsg
aavkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl

SCOPe Domain Coordinates for d1sgta_:

Click to download the PDB-style file with coordinates for d1sgta_.
(The format of our PDB-style files is described here.)

Timeline for d1sgta_: