PDB entry 1sgt

View 1sgt on RCSB PDB site
Description: refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
Class: hydrolase (serine proteinase)
Keywords: hydrolase (serine proteinase)
Deposited on 1988-04-13, released 1988-07-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00775 (0-222)
      • conflict (59-60)
    Domains in SCOPe 2.08: d1sgta_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1sgtA (A:)
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqsg
aavkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl