Lineage for d1sgt__ (1sgt -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins) 
Protein Trypsin [50504] (1 species) Species Streptomyces griseus, strain k1 [TaxId:1911] [50505] (1 PDB entry) 
Domain d1sgt__: 1sgt - [25814]
Details for d1sgt__
PDB Entry: 1sgt (more details), 1.7 Å
PDB Description: refined crystal structure of streptomyces griseus trypsin at 1.7 angstroms resolution
SCOP Domain Sequences for d1sgt__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sgt__ b.47.1.1 (-) Trypsin {Streptomyces griseus, strain k1}
vvggtraaqgefpfmvrlsmgcggalyaqdivltaahcvsgsgnntsitatggvvdlqsg
aavkvrstkvlqapgyngtgkdwaliklaqpinqptlkiatttaynqgtftvagwganre
ggsqqryllkanvpfvsdaacrsaygnelvaneeicagypdtggvdtcqgdsggpmfrkd
nadewiqvgivswgygcarpgypgvytevstfasaiasaartl
SCOP Domain Coordinates for d1sgt__:
Click to download the PDB-style file with coordinates for d1sgt__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sgt__:
- d1sgt__ appears in SCOP 1.57
- d1sgt__ appears in the current release, SCOPe 2.08, called d1sgta_
View in 3D