SCOPe 2.08: Domain d4pg3d1: 4pg3 D:80-227

Lineage for d4pg3d1 (4pg3 D:80-227)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.40: OB-fold [50198] (17 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)
Family b.40.4.0: automated matches [191416] (1 protein)
not a true family
Protein automated matches [190576] (52 species)
not a true protein
Species Plasmodium falciparum [TaxId:36329] [234564] (7 PDB entries)
Domain d4pg3d1: 4pg3 D:80-227 [258134]
Other proteins in same PDB: d4pg3a2, d4pg3b2, d4pg3c2, d4pg3d2
automated match to d3bjua1
complexed with krs, lys

Details for d4pg3d1

PDB Entry: 4pg3 (more details), 2.7 Å

PDB Description: crystal structure of krs complexed with inhibitor

PDB Compounds: (D:) Lysine--tRNA ligase

SCOPe Domain Sequences for d4pg3d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pg3d1 b.40.4.0 (D:80-227) automated matches {Plasmodium falciparum [TaxId: 36329]}
prlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitgri
mrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpgks
kkgelsifpketillsaclhmlpmkygl

SCOPe Domain Coordinates for d4pg3d1:

Click to download the PDB-style file with coordinates for d4pg3d1.
(The format of our PDB-style files is described here.)

Timeline for d4pg3d1: