![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Plasmodium falciparum [TaxId:36329] [234567] (7 PDB entries) |
![]() | Domain d4pg3c2: 4pg3 C:229-581 [263479] Other proteins in same PDB: d4pg3a1, d4pg3b1, d4pg3c1, d4pg3d1 automated match to d3bjua2 complexed with krs, lys |
PDB Entry: 4pg3 (more details), 2.7 Å
SCOPe Domain Sequences for d4pg3c2:
Sequence, based on SEQRES records: (download)
>d4pg3c2 d.104.1.0 (C:229-581) automated matches {Plasmodium falciparum [TaxId: 36329]} dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrp
>d4pg3c2 d.104.1.0 (C:229-581) automated matches {Plasmodium falciparum [TaxId: 36329]} dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie kvtntileqpfdsnetiekminiikehpptaaklldqlashfienkyndkpffivehpqi msplakyhrtkpglterlemficgkevlnaytelndpfkqkecfldsafctsleyglppt gglglgidritmfltnknsikdvilfptmrp
Timeline for d4pg3c2: