![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins) automatically mapped to Pfam PF06560 |
![]() | Protein automated matches [196263] (1 species) not a true protein |
![]() | Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries) |
![]() | Domain d4luma1: 4lum A:1-189 [257890] Other proteins in same PDB: d4luma2, d4lumb2 automated match to d1x82a_ complexed with f6r, mn; mutant |
PDB Entry: 4lum (more details), 1.79 Å
SCOPe Domain Sequences for d4luma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4luma1 b.82.1.7 (A:1-189) automated matches {Pyrococcus furiosus [TaxId: 186497]} mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi smepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk vvdnprwkk
Timeline for d4luma1: