SCOPe 2.08: Domain d4luma1: 4lum A:1-189

Lineage for d4luma1 (4lum A:1-189)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 proteins)
   automatically mapped to Pfam PF06560

6. Protein automated matches [196263] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)

8. Domain d4luma1: 4lum A:1-189 [257890]
   Other proteins in same PDB: d4luma2, d4lumb2
   automated match to d1x82a_
   complexed with f6r, mn; mutant

Details for d4luma1

PDB Entry: 4lum, 1.79 Å

PDB Description: the crystal structure of the p132v mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.

PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4luma1:

Sequence; same for both SEQRES and ATOM records:

>d4luma1 b.82.1.7 (A:1-189) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

Timeline for d4luma1:

• d4luma1 first appeared in SCOPe 2.04, called d4luma_
  
• d4luma1 appears in SCOPe 2.07