PDB entry 4lum

View 4lum on RCSB PDB site
Description: The crystal structure of the P132V mutant of Pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.
Class: isomerase
Keywords: Cupin Fold, Isomerase, Glucose 6-phosphate and Fructose 6-phosphate binding protein
Deposited on 2013-07-25, released 2014-07-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-189)
      • expression tag (0)
      • engineered mutation (132)
    Domains in SCOPe 2.08: d4luma1, d4luma2
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Pyrococcus furiosus [TaxId:186497]
    Gene: pgiA, PF0196
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83194 (1-189)
      • expression tag (0)
      • engineered mutation (132)
    Domains in SCOPe 2.08: d4lumb1, d4lumb2
  • Heterogens: MN, F6R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lumA (A:)
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprwkk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4lumB (B:)
mmykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveq
eekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakw
ismepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengev
kvvdnprwkk