Lineage for d4lumb1 (4lum B:1-189)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2403752Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2404022Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 protein domains)
    automatically mapped to Pfam PF06560
  6. 2404050Protein automated matches [196263] (1 species)
    not a true protein
  7. 2404051Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)
  8. 2404055Domain d4lumb1: 4lum B:1-189 [262990]
    Other proteins in same PDB: d4luma2, d4lumb2
    automated match to d4luma_
    complexed with f6r, mn; mutant

Details for d4lumb1

PDB Entry: 4lum (more details), 1.79 Å

PDB Description: the crystal structure of the p132v mutant of pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.
PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4lumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lumb1 b.82.1.7 (B:1-189) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

SCOPe Domain Coordinates for d4lumb1:

Click to download the PDB-style file with coordinates for d4lumb1.
(The format of our PDB-style files is described here.)

Timeline for d4lumb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4lumb2