SCOPe 2.06: Domain d4lumb1: 4lum B:1-189

Lineage for d4lumb1 (4lum B:1-189)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 protein domains)
   automatically mapped to Pfam PF06560

6. Protein automated matches [196263] (1 species)
   not a true protein

7. Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)

8. Domain d4lumb1: 4lum B:1-189 [262990]
   Other proteins in same PDB: d4luma2, d4lumb2
   automated match to d4luma_
   complexed with f6r, mn; mutant

Details for d4lumb1

PDB Entry: 4lum, 1.79 Å

PDB Description: The crystal structure of the P132V mutant of Pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.

PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4lumb1:

Sequence; same for both SEQRES and ATOM records:

>d4lumb1 b.82.1.7 (B:1-189) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

Timeline for d4lumb1:

• d4lumb1 first appeared in SCOPe 2.05, called d4lumb_