SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4lumb1 (4lum B:1-189)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070015Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2070276Family b.82.1.7: Glucose-6-phosphate isomerase, GPI [89403] (2 protein domains)
    automatically mapped to Pfam PF06560
  6. 2070304Protein automated matches [196263] (1 species)
    not a true protein
  7. 2070305Species Pyrococcus furiosus [TaxId:186497] [196264] (5 PDB entries)
  8. 2070309Domain d4lumb1: 4lum B:1-189 [262990]
    Other proteins in same PDB: d4luma2, d4lumb2
    automated match to d4luma_
    complexed with f6r, mn; mutant

Details for d4lumb1

PDB Entry: 4lum (more details), 1.79 Å

PDB Description: The crystal structure of the P132V mutant of Pyrococcus furiosus phosphoglucose isomerase in complex with manganese and fructose-6- phosphate.
PDB Compounds: (B:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d4lumb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lumb1 b.82.1.7 (B:1-189) automated matches {Pyrococcus furiosus [TaxId: 186497]}
mykepfgvkvdfetgiiegakksvrrlsdmegyfvderawkelvekedpvvyevyaveqe
ekegdlnfattvlypgkvgkeffftkghfhakldraevyvalkgkggmllqtpegdakwi
smepgtvvyvpvywahrtvnigdepfiflaiypadaghdygtiaekgfskivieengevk
vvdnprwkk

SCOPe Domain Coordinates for d4lumb1:

Click to download the PDB-style file with coordinates for d4lumb1.
(The format of our PDB-style files is described here.)

Timeline for d4lumb1:

  • d4lumb1 first appeared in SCOPe 2.05, called d4lumb_

2070309
d4lumb1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d4lumb2