Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein automated matches [190420] (8 species) not a true protein |
Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (7 PDB entries) |
Domain d4lhqc_: 4lhq C: [257837] automated match to d1br5a_ |
PDB Entry: 4lhq (more details), 2.3 Å
SCOPe Domain Sequences for d4lhqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lhqc_ d.165.1.1 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]} kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy dvsilipiialmvyrcappp
Timeline for d4lhqc_: