Lineage for d4lhqc_ (4lhq C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681285Protein automated matches [190420] (8 species)
    not a true protein
  7. 1681289Species Castor bean (Ricinus communis) [TaxId:3988] [188830] (7 PDB entries)
  8. 1681296Domain d4lhqc_: 4lhq C: [257837]
    automated match to d1br5a_

Details for d4lhqc_

PDB Entry: 4lhq (more details), 2.3 Å

PDB Description: ricin a chain bound to camelid nanobody (vhh8)
PDB Compounds: (C:) ricin

SCOPe Domain Sequences for d4lhqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhqc_ d.165.1.1 (C:) automated matches {Castor bean (Ricinus communis) [TaxId: 3988]}
kqypiinfttagatvqsytnfiravrgrlttgadvrheipvlpnrvglpinqrfilvels
nhaelsvtlaldvtnayvvgyragnsayffhpdnqedaeaithlftdvqnrytfafggny
drleqlagnlrenielgngpleeaisalyyystggtqlptlarsfiiciqmiseaarfqy
iegemrtrirynrrsapdpsvitlenswgrlstaiqesnqgafaspiqlqrrngskfsvy
dvsilipiialmvyrcappp

SCOPe Domain Coordinates for d4lhqc_:

Click to download the PDB-style file with coordinates for d4lhqc_.
(The format of our PDB-style files is described here.)

Timeline for d4lhqc_: