Lineage for d4qd2e1 (4qd2 E:2-101)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2037192Superfamily b.1.6: Cadherin-like [49313] (3 families) (S)
  5. 2037193Family b.1.6.1: Cadherin [49314] (4 proteins)
  6. 2037201Protein E-cadherin (epithelial) [49317] (2 species)
    synonym: uvomorulin
  7. 2037224Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)
  8. 2037256Domain d4qd2e1: 4qd2 E:2-101 [257658]
    Other proteins in same PDB: d4qd2c1, d4qd2c2, d4qd2d1, d4qd2d2, d4qd2d3, d4qd2h1, d4qd2h2, d4qd2h3, d4qd2i1, d4qd2i2, d4qd2i3
    automated match to d1ff5a1
    complexed with ca

Details for d4qd2e1

PDB Entry: 4qd2 (more details), 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
PDB Compounds: (E:) Cadherin-1

SCOPe Domain Sequences for d4qd2e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd2e1 b.1.6.1 (E:2-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngeavedpmeivitvtdq

SCOPe Domain Coordinates for d4qd2e1:

Click to download the PDB-style file with coordinates for d4qd2e1.
(The format of our PDB-style files is described here.)

Timeline for d4qd2e1: