SCOPe 2.08: Domain d4qd2e1: 4qd2 E:2-101

Lineage for d4qd2e1 (4qd2 E:2-101)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.6: Cadherin-like [49313] (4 families)

5. Family b.1.6.1: Cadherin [49314] (4 proteins)

6. Protein E-cadherin (epithelial) [49317] (2 species)
   synonym: uvomorulin

7. Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries)

8. Domain d4qd2e1: 4qd2 E:2-101 [257658]
   Other proteins in same PDB: d4qd2c1, d4qd2c2, d4qd2d1, d4qd2d2, d4qd2d3, d4qd2h1, d4qd2h2, d4qd2h3, d4qd2i1, d4qd2i2, d4qd2i3
   automated match to d1ff5a1
   complexed with ca

Details for d4qd2e1

PDB Entry: 4qd2, 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex

PDB Compounds: (E:) Cadherin-1

SCOPe Domain Sequences for d4qd2e1:

Sequence; same for both SEQRES and ATOM records:

>d4qd2e1 b.1.6.1 (E:2-101) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
wvippiscpenekgefpknlvqiksnrdketkvfysitgqgadkppvgvfiieretgwlk
vtqpldreaiakyilyshavssngeavedpmeivitvtdq

Timeline for d4qd2e1:

• d4qd2e1 first appeared in SCOPe 2.04
  
• d4qd2e1 appears in SCOPe 2.07