Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) |
Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
Protein automated matches [226913] (9 species) not a true protein |
Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries) |
Domain d4qd2h1: 4qd2 H:9-151 [258345] Other proteins in same PDB: d4qd2c2, d4qd2d3, d4qd2e1, d4qd2e2, d4qd2h3, d4qd2i3, d4qd2j1, d4qd2j2 automated match to d4lo0a1 complexed with ca |
PDB Entry: 4qd2 (more details), 2.4 Å
SCOPe Domain Sequences for d4qd2h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qd2h1 b.42.2.0 (H:9-151) automated matches {Clostridium botulinum [TaxId: 1491]} nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk lstlnnsnyikfiiedyiisdln
Timeline for d4qd2h1: