Lineage for d4qd2h1 (4qd2 H:9-151)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061886Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 2062118Family b.42.2.0: automated matches [227190] (1 protein)
    not a true family
  6. 2062119Protein automated matches [226913] (9 species)
    not a true protein
  7. 2062123Species Clostridium botulinum [TaxId:1491] [254975] (8 PDB entries)
  8. 2062149Domain d4qd2h1: 4qd2 H:9-151 [258345]
    Other proteins in same PDB: d4qd2c2, d4qd2d3, d4qd2e1, d4qd2e2, d4qd2h3, d4qd2i3, d4qd2j1, d4qd2j2
    automated match to d4lo0a1
    complexed with ca

Details for d4qd2h1

PDB Entry: 4qd2 (more details), 2.4 Å

PDB Description: Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex
PDB Compounds: (H:) Hemagglutinin component HA33

SCOPe Domain Sequences for d4qd2h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qd2h1 b.42.2.0 (H:9-151) automated matches {Clostridium botulinum [TaxId: 1491]}
nslndkivtisckadtnlffyqvagnvslfqqtrnylerwrliydsnkaaykiksmdihn
tnlvltwnapthnistqqdsnadnqywlllkdignnsfiiasyknpnlvlyadtvarnlk
lstlnnsnyikfiiedyiisdln

SCOPe Domain Coordinates for d4qd2h1:

Click to download the PDB-style file with coordinates for d4qd2h1.
(The format of our PDB-style files is described here.)

Timeline for d4qd2h1: