Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Streptomyces coelicolor [TaxId:100226] [257350] (3 PDB entries) |
Domain d4oy7b_: 4oy7 B: [257353] automated match to d4gboa_ complexed with ca, cu |
PDB Entry: 4oy7 (more details), 1.5 Å
SCOPe Domain Sequences for d4oy7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4oy7b_ b.1.18.0 (B:) automated matches {Streptomyces coelicolor [TaxId: 100226]} hgvammpgsrtylcqldaktgtgaldptnpacqaaldqsgatalynwfavldsnaggrga gyvpdgtlcsagdrspydfsaynaarsdwprthltsgatipveysnwaahpgdfrvyltk pgwsptselgwddleliqtvtnppqqgspgtdgghyywdlalpsgrsgdalifmqwvrsd sqenffscsdvvfdgg
Timeline for d4oy7b_: