Lineage for d4oy7g_ (4oy7 G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376346Species Streptomyces coelicolor [TaxId:100226] [257350] (3 PDB entries)
  8. 2376354Domain d4oy7g_: 4oy7 G: [263376]
    automated match to d4oy7a_
    complexed with ca, cu

Details for d4oy7g_

PDB Entry: 4oy7 (more details), 1.5 Å

PDB Description: Structure of cellulose active LPMO CelS2 (ScLPMO10C) in complex with Copper.
PDB Compounds: (G:) Putative secreted cellulose binding protein

SCOPe Domain Sequences for d4oy7g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oy7g_ b.1.18.0 (G:) automated matches {Streptomyces coelicolor [TaxId: 100226]}
hgvammpgsrtylcqldaktgtgaldptnpacqaaldqsgatalynwfavldsnaggrga
gyvpdgtlcsagdrspydfsaynaarsdwprthltsgatipveysnwaahpgdfrvyltk
pgwsptselgwddleliqtvtnppqqgspgtdgghyywdlalpsgrsgdalifmqwvrsd
sqenffscsdvvfdgg

SCOPe Domain Coordinates for d4oy7g_:

Click to download the PDB-style file with coordinates for d4oy7g_.
(The format of our PDB-style files is described here.)

Timeline for d4oy7g_: