| Class b: All beta proteins [48724] (178 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (72 species) not a true protein |
| Species Thermobifida fusca [TaxId:2021] [256269] (2 PDB entries) |
| Domain d4gboa_: 4gbo A: [252189] automated match to d2bena_ complexed with cu, gol, iod, na |
PDB Entry: 4gbo (more details), 2 Å
SCOPe Domain Sequences for d4gboa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4gboa_ b.1.18.0 (A:) automated matches {Thermobifida fusca [TaxId: 2021]}
hgsvinpatrnygcwlrwghdhlnpnmqyedpmcwqawqdnpnamwnwnglyrdwvggnh
raalpdgqlcsgglteggryrsmdavgpwkttdvnntftihlydqashgadyflvyvtkq
gfdpttqpltwdslelvhqtgsyppaqniqftvhapnrsgrhvvftiwkashmdqtyylc
sdvnfv
Timeline for d4gboa_: