SCOPe 2.04: Domain d4oiof2: 4oio F:258-318

Lineage for d4oiof2 (4oio F:258-318)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.0: automated matches [254211] (1 protein)
   not a true family

6. Protein automated matches [254475] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [257268] (3 PDB entries)

8. Domain d4oiof2: 4oio F:258-318 [257269]
   Other proteins in same PDB: d4oioc_, d4oiod_, d4oioe_, d4oiof1
   automated match to d1smyf1
   protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4oiof2

PDB Entry: 4oio, 3.1 Å

PDB Description: Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation

PDB Compounds: (F:) DNA directed RNA polymerase sigma factor A

SCOPe Domain Sequences for d4oiof2:

Sequence; same for both SEQRES and ATOM records:

>d4oiof2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

Timeline for d4oiof2:

• d4oiof2 is new in SCOPe 2.04-stable
  
• d4oiof2 appears in SCOPe 2.05
  
• d4oiof2 appears in the current release, SCOPe 2.08