Lineage for d4oioc_ (4oio C:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1694801Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1694802Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1694803Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1694836Protein RNA-polymerase beta [64488] (2 species)
  7. 1694842Species Thermus thermophilus [TaxId:274] [75609] (8 PDB entries)
    Uniprot Q8RQE9; part of multichain biological unit
  8. 1694851Domain d4oioc_: 4oio C: [257260]
    Other proteins in same PDB: d4oiod_, d4oioe_, d4oiof1, d4oiof2, d4oiof3
    automated match to d1smyc_
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4oioc_

PDB Entry: 4oio (more details), 3.1 Å

PDB Description: Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
PDB Compounds: (C:) DNA-directed RNA polymerase subunit beta

SCOPe Domain Sequences for d4oioc_:

Sequence, based on SEQRES records: (download)

>d4oioc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
vpesfrvlvkelqalaldvqtldekdnpvdifeglask

Sequence, based on observed residues (ATOM records): (download)

>d4oioc_ e.29.1.1 (C:) RNA-polymerase beta {Thermus thermophilus [TaxId: 274]}
meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieelvld
fleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsf
iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvn
krkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgdp
pkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflptl
rylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgsedsl
tpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfdv
rdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvymt
ateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnli
pflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvd
gnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfla
lgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdip
hlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvkd
tslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnkg
vvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispifd
gakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkelf
lqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqf
ggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrv
lvkelqalaldvqtldekdnpvdifeglask

SCOPe Domain Coordinates for d4oioc_:

Click to download the PDB-style file with coordinates for d4oioc_.
(The format of our PDB-style files is described here.)

Timeline for d4oioc_: