Lineage for d4oiof2 (4oio F:258-318)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695832Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) (S)
  5. 2695938Family a.4.13.0: automated matches [254211] (1 protein)
    not a true family
  6. 2695939Protein automated matches [254475] (4 species)
    not a true protein
  7. 2695967Species Thermus thermophilus [TaxId:300852] [257268] (3 PDB entries)
  8. 2695968Domain d4oiof2: 4oio F:258-318 [257269]
    Other proteins in same PDB: d4oioc_, d4oiod_, d4oioe_, d4oiof1
    automated match to d1smyf1
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4oiof2

PDB Entry: 4oio (more details), 3.1 Å

PDB Description: Crystal structure of Thermus thermophilus pre-insertion substrate complex for de novo transcription initiation
PDB Compounds: (F:) DNA directed RNA polymerase sigma factor A

SCOPe Domain Sequences for d4oiof2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oiof2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d4oiof2:

Click to download the PDB-style file with coordinates for d4oiof2.
(The format of our PDB-style files is described here.)

Timeline for d4oiof2: