![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.3: Translation proteins [50447] (7 families) ![]() |
![]() | Family b.43.3.1: Elongation factors [50448] (11 proteins) |
![]() | Protein Initiation factor IF2/eIF5b, domains 2 and 4 [50458] (2 species) the C-terminal domain 4 has the same fold as domain 2; it probably binds fMet-tRNAfmet |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [50460] (1 PDB entry) |
![]() | Domain d1d1na_: 1d1n A: [25718] domain 4 only |
PDB Entry: 1d1n (more details)
SCOPe Domain Sequences for d1d1na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]} yeekvigqaevrqtfkvskvgtiagcyvtdgkitrdskvrlirqgivvyegeidslkryk ddvrevaqgyecgltiknfndikegdvieayvmqevara
Timeline for d1d1na_: