Lineage for d1d1na_ (1d1n A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793147Protein Initiation factor IF2/eIF5b, domains 2 and 4 [50458] (2 species)
    the C-terminal domain 4 has the same fold as domain 2; it probably binds fMet-tRNAfmet
  7. 2793148Species Bacillus stearothermophilus [TaxId:1422] [50460] (1 PDB entry)
  8. 2793149Domain d1d1na_: 1d1n A: [25718]
    domain 4 only

Details for d1d1na_

PDB Entry: 1d1n (more details)

PDB Description: solution structure of the fmet-trnafmet binding domain of becillus stearothermophillus translation initiation factor if2
PDB Compounds: (A:) initiation factor 2

SCOPe Domain Sequences for d1d1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus [TaxId: 1422]}
yeekvigqaevrqtfkvskvgtiagcyvtdgkitrdskvrlirqgivvyegeidslkryk
ddvrevaqgyecgltiknfndikegdvieayvmqevara

SCOPe Domain Coordinates for d1d1na_:

Click to download the PDB-style file with coordinates for d1d1na_.
(The format of our PDB-style files is described here.)

Timeline for d1d1na_: