Lineage for d1d1na_ (1d1n A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14602Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)
  4. 14691Superfamily b.43.3: Translation proteins [50447] (2 families) (S)
  5. 14692Family b.43.3.1: Elongation factors [50448] (4 proteins)
  6. 14734Protein Initiation factor IF2/eIF5b, domains 2 and 4 [50458] (2 species)
  7. 14742Species Bacillus stearothermophilus [TaxId:1422] [50460] (1 PDB entry)
  8. 14743Domain d1d1na_: 1d1n A: [25718]

Details for d1d1na_

PDB Entry: 1d1n (more details)

PDB Description: solution structure of the fmet-trnafmet binding domain of becillus stearothermophillus translation initiation factor if2

SCOP Domain Sequences for d1d1na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1na_ b.43.3.1 (A:) Initiation factor IF2/eIF5b, domains 2 and 4 {Bacillus stearothermophilus}
yeekvigqaevrqtfkvskvgtiagcyvtdgkitrdskvrlirqgivvyegeidslkryk
ddvrevaqgyecgltiknfndikegdvieayvmqevara

SCOP Domain Coordinates for d1d1na_:

Click to download the PDB-style file with coordinates for d1d1na_.
(The format of our PDB-style files is described here.)

Timeline for d1d1na_: