PDB entry 1d1n

View 1d1n on RCSB PDB site
Description: solution structure of the fmet-trnafmet binding domain of becillus stearothermophillus translation initiation factor if2
Class: gene regulation
Keywords: beta-barrel, gene regulation
Deposited on 1999-09-20, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: initiation factor 2
  Species: Geobacillus stearothermophilus [TaxId:1422]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04766 (0-98)
  Domains in SCOPe 2.08: d1d1na_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d1nA (A:)
  yeekvigqaevrqtfkvskvgtiagcyvtdgkitrdskvrlirqgivvyegeidslkryk
  ddvrevaqgyecgltiknfndikegdvieayvmqevara