PDB entry 1d1n

View 1d1n on RCSB PDB site
Description: solution structure of the fmet-trnafmet binding domain of becillus stearothermophillus translation initiation factor if2
Class: gene regulation
Keywords: beta-barrel, gene regulation
Deposited on 1999-09-20, released 2000-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: initiation factor 2
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d1na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d1nA (A:)
    yeekvigqaevrqtfkvskvgtiagcyvtdgkitrdskvrlirqgivvyegeidslkryk
    ddvrevaqgyecgltiknfndikegdvieayvmqevara