SCOPe 2.08: Domain d4np4m1: 4np4 M:1-107

Lineage for d4np4m1 (4np4 M:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d4np4m1: 4np4 M:1-107 [257174]
   Other proteins in same PDB: d4np4h_, d4np4i_, d4np4l2, d4np4m2
   automated match to d1dn0a1

Details for d4np4m1

PDB Entry: 4np4, 2.89 Å

PDB Description: clostridium difficile toxin b crop domain in complex with fab domains of neutralizing antibody bezlotoxumab

PDB Compounds: (M:) bezlotoxumab light chain

SCOPe Domain Sequences for d4np4m1:

Sequence; same for both SEQRES and ATOM records:

>d4np4m1 b.1.1.1 (M:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspgtlslspgeratlscrasqsvsssylawyqqkpgqaprlliygassratgip
drfsgsgsgtdftltisrlepedfavyycqqygsstwtfgqgtkvei

Timeline for d4np4m1:

• d4np4m1 first appeared in SCOPe 2.04
  
• d4np4m1 appears in SCOPe 2.07