SCOPe 2.04: Domain d4mvwb1: 4mvw B:-4-606

Lineage for d4mvwb1 (4mvw B:-4-606)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (36 species)
   not a true protein

7. Species Trypanosoma brucei [TaxId:999953] [226467] (6 PDB entries)

8. Domain d4mvwb1: 4mvw B:-4-606 [257111]
   Other proteins in same PDB: d4mvwb2
   automated match to d4eg8b1
   protein/RNA complex; complexed with 43e, dms, gol, met, so4

Details for d4mvwb1

PDB Entry: 4mvw, 2.9 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-thiophen-3-ylurea (Chem 1433)

PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mvwb1:

Sequence; same for both SEQRES and ATOM records:

>d4mvwb1 c.26.1.0 (B:-4-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
gpgsmkvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgq
kvaeaakqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqk
gdiylgryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsa
frerllewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcv
yvwldaltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafl
lsaglplpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddg
dysdknmiarlngel

Timeline for d4mvwb1:

• d4mvwb1 is new in SCOPe 2.04-stable
  
• d4mvwb1 appears in SCOPe 2.05
  
• d4mvwb1 appears in the current release, SCOPe 2.08