Lineage for d4mvwb1 (4mvw B:237-606)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860806Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2860807Protein automated matches [190459] (61 species)
    not a true protein
  7. 2861163Species Trypanosoma brucei [TaxId:999953] [226467] (29 PDB entries)
  8. 2861190Domain d4mvwb1: 4mvw B:237-606 [257111]
    Other proteins in same PDB: d4mvwa2, d4mvwb2, d4mvwb3
    automated match to d4eg8b1
    protein/RNA complex; complexed with 43e, dms, gol, met, so4

Details for d4mvwb1

PDB Entry: 4mvw (more details), 2.9 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-thiophen-3-ylurea (Chem 1433)
PDB Compounds: (B:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mvwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mvwb1 c.26.1.0 (B:237-606) automated matches {Trypanosoma brucei [TaxId: 999953]}
kvekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaea
akqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiyl
gryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerl
lewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwld
altnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsagl
plpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdk
nmiarlngel

SCOPe Domain Coordinates for d4mvwb1:

Click to download the PDB-style file with coordinates for d4mvwb1.
(The format of our PDB-style files is described here.)

Timeline for d4mvwb1: