SCOP 1.55: Domain d1f60a1: 1f60 A:241-334

Lineage for d1f60a1 (1f60 A:241-334)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (3 superfamilies)

4. Superfamily b.43.3: Translation proteins [50447] (2 families)

5. Family b.43.3.1: Elongation factors [50448] (4 proteins)

6. Protein Elongation factor eEF-1alpha, domain 2 [50454] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [50455] (2 PDB entries)

8. Domain d1f60a1: 1f60 A:241-334 [25705]
   Other proteins in same PDB: d1f60a2, d1f60a3, d1f60b_

Details for d1f60a1

PDB Entry: 1f60, 1.67 Å

PDB Description: crystal structure of the yeast elongation factor complex eef1a:eef1ba

SCOP Domain Sequences for d1f60a1:

Sequence; same for both SEQRES and ATOM records:

>d1f60a1 b.43.3.1 (A:241-334) Elongation factor eEF-1alpha, domain 2 {Baker's yeast (Saccharomyces cerevisiae)}
dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
vpgdnvgfnvknvsvkeirrgnvcgdakndppkg

Timeline for d1f60a1:

• d1f60a1 appears in SCOP 1.57
  
• d1f60a1 appears in the current release, SCOPe 2.08