![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily) multihelical; segment-swapped dimer |
![]() | Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) ![]() automatically mapped to Pfam PF08278 |
![]() | Family a.236.1.0: automated matches [256784] (1 protein) not a true family |
![]() | Protein automated matches [256785] (1 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:345073] [256786] (1 PDB entry) |
![]() | Domain d4im9a_: 4im9 A: [256787] Other proteins in same PDB: d4im9b2, d4im9c2 automated match to d1t3wb_ protein/DNA complex |
PDB Entry: 4im9 (more details), 2.46 Å
SCOPe Domain Sequences for d4im9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4im9a_ a.236.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]} tpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehwr dsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqakersvglsteek relqdlilkglk
Timeline for d4im9a_:
![]() Domains from other chains: (mouse over for more information) d4im9b1, d4im9b2, d4im9c1, d4im9c2 |