Lineage for d4im9a_ (4im9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737962Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. 2737963Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) (S)
    automatically mapped to Pfam PF08278
  5. 2737978Family a.236.1.0: automated matches [256784] (1 protein)
    not a true family
  6. 2737979Protein automated matches [256785] (1 species)
    not a true protein
  7. 2737980Species Vibrio cholerae [TaxId:345073] [256786] (1 PDB entry)
  8. 2737981Domain d4im9a_: 4im9 A: [256787]
    Other proteins in same PDB: d4im9b2, d4im9c2
    automated match to d1t3wb_
    protein/DNA complex

Details for d4im9a_

PDB Entry: 4im9 (more details), 2.46 Å

PDB Description: Cystal structure of DnaG primase C-terminal domain from Vibrio cholerae
PDB Compounds: (A:) DNA primase

SCOPe Domain Sequences for d4im9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4im9a_ a.236.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 345073]}
tpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehwr
dsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqakersvglsteek
relqdlilkglk

SCOPe Domain Coordinates for d4im9a_:

Click to download the PDB-style file with coordinates for d4im9a_.
(The format of our PDB-style files is described here.)

Timeline for d4im9a_: