Lineage for d1t3wb_ (1t3w B:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
multihelical; segment-swapped dimerSuperfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) 
automatically mapped to Pfam PF08278Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (2 proteins) 
Protein DNA primase DnaG, C-terminal domain [117025] (1 species) Species Escherichia coli [TaxId:562] [117026] (2 PDB entries)
Uniprot P02923 447-580 # structure of the core domain (115-427) is also known, (56734)
Domain d1t3wb_: 1t3w B: [112234]
complexed with acy
Details for d1t3wb_
PDB Entry: 1t3w (more details), 2.8 Å
PDB Description: crystal structure of the e.coli dnag c-terminal domain (residues 434 to 581)
PDB Compounds: (B:) DNA primaseSCOPe Domain Sequences for d1t3wb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3wb_ a.236.1.1 (B:) DNA primase DnaG, C-terminal domain {Escherichia coli [TaxId: 562]}
krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
erlelwtlnqelakk
SCOPe Domain Coordinates for d1t3wb_:
Click to download the PDB-style file with coordinates for d1t3wb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1t3wb_:
- d1t3wb_ first appeared in SCOP 1.71
- d1t3wb_ appears in SCOPe 2.07
View in 3D
