Lineage for d1t3wa_ (1t3w A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015796Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
    multihelical; segment-swapped dimer
  4. 2015797Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families) (S)
    automatically mapped to Pfam PF08278
  5. 2015798Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (1 protein)
  6. 2015799Protein DNA primase DnaG, C-terminal domain [117025] (1 species)
  7. 2015800Species Escherichia coli [TaxId:562] [117026] (2 PDB entries)
    Uniprot P02923 447-580 # structure of the core domain (115-427) is also known, (56734)
  8. 2015801Domain d1t3wa_: 1t3w A: [112233]
    complexed with acy

Details for d1t3wa_

PDB Entry: 1t3w (more details), 2.8 Å

PDB Description: Crystal Structure of the E.coli DnaG C-terminal domain (residues 434 to 581)
PDB Compounds: (A:) DNA primase

SCOPe Domain Sequences for d1t3wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t3wa_ a.236.1.1 (A:) DNA primase DnaG, C-terminal domain {Escherichia coli [TaxId: 562]}
krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
erlelwtlnqelak

SCOPe Domain Coordinates for d1t3wa_:

Click to download the PDB-style file with coordinates for d1t3wa_.
(The format of our PDB-style files is described here.)

Timeline for d1t3wa_: