SCOPe 2.08: Domain d1t3wb_: 1t3w B:

Lineage for d1t3wb_ (1t3w B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
   multihelical; segment-swapped dimer

4. Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families)
   automatically mapped to Pfam PF08278

5. Family a.236.1.1: DNA primase DnaG, C-terminal domain [117024] (2 proteins)

6. Protein DNA primase DnaG, C-terminal domain [117025] (1 species)

7. Species Escherichia coli [TaxId:562] [117026] (2 PDB entries)
   Uniprot P02923 447-580 # structure of the core domain (115-427) is also known, (56734)

8. Domain d1t3wb_: 1t3w B: [112234]
   complexed with acy

Details for d1t3wb_

PDB Entry: 1t3w, 2.8 Å

PDB Description: crystal structure of the e.coli dnag c-terminal domain (residues 434 to 581)

PDB Compounds: (B:) DNA primase

SCOPe Domain Sequences for d1t3wb_:

Sequence; same for both SEQRES and ATOM records:

>d1t3wb_ a.236.1.1 (B:) DNA primase DnaG, C-terminal domain {Escherichia coli [TaxId: 562]}
krttmriligllvqnpelatlvpplenldenklpglglfrelvntclsqpglttgqlleh
yrgtnnaatleklsmwddiadkniaeqtftdslnhmfdsllelrqeeliarerthglsne
erlelwtlnqelakk

Timeline for d1t3wb_:

• d1t3wb_ first appeared in SCOP 1.71
  
• d1t3wb_ appears in SCOPe 2.07