SCOPe 2.08: Domain d4im9c1: 4im9 C:12-144

Lineage for d4im9c1 (4im9 C:12-144)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.236: DNA primase DnaG, C-terminal domain [117022] (1 superfamily)
   multihelical; segment-swapped dimer

4. Superfamily a.236.1: DNA primase DnaG, C-terminal domain [117023] (2 families)
   automatically mapped to Pfam PF08278

5. Family a.236.1.0: automated matches [256784] (1 protein)
   not a true family

6. Protein automated matches [256785] (1 species)
   not a true protein

7. Species Vibrio cholerae [TaxId:345073] [256786] (1 PDB entry)

8. Domain d4im9c1: 4im9 C:12-144 [262728]
   Other proteins in same PDB: d4im9b2, d4im9c2
   automated match to d4im9a_
   protein/DNA complex

Details for d4im9c1

PDB Entry: 4im9, 2.46 Å

PDB Description: Cystal structure of DnaG primase C-terminal domain from Vibrio cholerae

PDB Compounds: (C:) DNA primase

SCOPe Domain Sequences for d4im9c1:

Sequence; same for both SEQRES and ATOM records:

>d4im9c1 a.236.1.0 (C:12-144) automated matches {Vibrio cholerae [TaxId: 345073]}
tpmrdvialliqnpsyaelvpdlasvrhlmipgldtfsevlekcrqyphittgqllehwr
dsknetllsrlasweiplvednqeelfldsldkilaqcvekqienlqakersvglsteek
relqdlilkglka

Timeline for d4im9c1:

• d4im9c1 first appeared in SCOPe 2.05, called d4im9c_
  
• d4im9c1 appears in SCOPe 2.07