Lineage for d4czla1 (4czl A:9-149)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606151Species Caulobacter vibrioides [TaxId:155892] [256751] (4 PDB entries)
  8. 1606154Domain d4czla1: 4czl A:9-149 [256756]
    automated match to d1jcea1
    complexed with adp, mg

Details for d4czla1

PDB Entry: 4czl (more details), 1.6 Å

PDB Description: C. crescentus MreB, monomeric, ADP
PDB Compounds: (A:) rod shape-determining protein mreb

SCOPe Domain Sequences for d4czla1:

Sequence, based on SEQRES records: (download)

>d4czla1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
isndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlgrtpghm
eairpmrdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindscl
nagarrvglidepmaaaigag

Sequence, based on observed residues (ATOM records): (download)

>d4czla1 c.55.1.0 (A:9-149) automated matches {Caulobacter vibrioides [TaxId: 155892]}
isndiaidlgtantliyqkgkgivlnepsvvalrnvggrkvvhavgieakqmlmeairpm
rdgviadfevaeemikyfirkvhnrkgsgnpkvivcvpsgataverraindsclnagarr
vglidepmaaaigag

SCOPe Domain Coordinates for d4czla1:

Click to download the PDB-style file with coordinates for d4czla1.
(The format of our PDB-style files is described here.)

Timeline for d4czla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4czla2