Lineage for d1jcea1 (1jce A:4-140)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) 
Protein Prokaryotic actin homolog MreB [64087] (1 species) Species Thermotoga maritima [TaxId:2336] [64088] (4 PDB entries) 
Domain d1jcea1: 1jce A:4-140 [62876]
Details for d1jcea1
PDB Entry: 1jce (more details), 2.1 Å
PDB Description: mreb from thermotoga maritima
PDB Compounds: (A:) rod shape-determining protein mrebSCOPe Domain Sequences for d1jcea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]}
kdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatikair
pmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagleaga
skvflieepmaaaigsn
SCOPe Domain Coordinates for d1jcea1:
Click to download the PDB-style file with coordinates for d1jcea1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jcea1:
- d1jcea1 first appeared in SCOP 1.57
- d1jcea1 appears in SCOPe 2.03
- d1jcea1 appears in SCOPe 2.05
- d1jcea1 appears in the current release, SCOPe 2.08
View in 3D
