![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Prokaryotic actin homolog MreB [64087] (1 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [64088] (4 PDB entries) |
![]() | Domain d1jcea1: 1jce A:4-140 [62876] |
PDB Entry: 1jce (more details), 2.1 Å
SCOPe Domain Sequences for d1jcea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} kdigidlgtantlvflrgkgivvnepsviaidsttgeilkvgleaknmigktpatikair pmrdgviadytvalvmlryfinkakggmnlfkprvvigvpigitdverraildagleaga skvflieepmaaaigsn
Timeline for d1jcea1: